PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN43793.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 242aa    MW: 26681.5 Da    PI: 7.8012
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN43793.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.54.8e-112054439
                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkq 39
                     W ++Ed +l++ v+++G+ +W++Ia+++  gRt+k+
       KHN43793.1 20 WKKDEDVKLLQQVREHGPQNWRSIASHLE-GRTGKS 54
                     *****************************.***985 PP

2Myb_DNA-binding271.1e-08871131947
                      TTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  19 lGggtWktIartmgkgRtlkqcksrwqky 47 
                      +G + W++I++ ++ gRt++ +k++w+  
       KHN43793.1  87 YGAR-WALISKLFN-GRTDNAVKNHWHVM 113
                      7999.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.8341264IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-111454IPR009057Homeodomain-like
SMARTSM007173.3E-51669IPR001005SANT/Myb domain
PfamPF002498.7E-101954IPR001005SANT/Myb domain
SuperFamilySSF466891.43E-1619113IPR009057Homeodomain-like
CDDcd001672.10E-92063No hitNo description
SMARTSM007171478116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.9E-887111IPR009057Homeodomain-like
PfamPF002492.4E-687112IPR001005SANT/Myb domain
PROSITE profilePS500905.28587114IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MANSSAAAED ITNRLRVNYW KKDEDVKLLQ QVREHGPQNW RSIASHLEGR TGKSELDVVI  60
NKFGYVMGRS NSNVILIFTG SITKLVYGAR WALISKLFNG RTDNAVKNHW HVMRARKRRE  120
SKQKNWPGVF QDSYASSSSN TVLHPNGPNP HDMVCPSNGS SSSAKFGTIP SFADSTPVNG  180
SDHFGLFNGA DDAMLQRSLF DNSFAEFGSS SSSVQVQADE ESNGSGQKEV PFFDFLGVGD  240
DQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-152011730127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006596265.11e-144PREDICTED: transcription factor WER-like
TrEMBLA0A0B2SG640.0A0A0B2SG64_GLYSO; Transforming protein Myb
STRINGGLYMA14G27235.11e-144(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2020555
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17800.17e-26myb domain protein 56
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]